PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G450800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 315aa    MW: 34751.7 Da    PI: 4.8058
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G450800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.14.6e-192370148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg+WT eEd+llv++++ +G g+W++ ar+ g++Rt+k+c++rw++yl
  Sevir.2G450800.1.p 23 RGPWTVEEDLLLVNYIAVHGEGRWNALARCAGLRRTGKSCRLRWLNYL 70
                        89********************************************97 PP

2Myb_DNA-binding50.83.8e-1676119146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg+ T++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Sevir.2G450800.1.p  76 RGNITAQEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 119
                         7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.6381870IPR017930Myb domain
SuperFamilySSF466899.36E-3121117IPR009057Homeodomain-like
SMARTSM007178.8E-162272IPR001005SANT/Myb domain
PfamPF002498.8E-172370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.3E-232477IPR009057Homeodomain-like
CDDcd001671.39E-122570No hitNo description
PROSITE profilePS5129423.12571125IPR017930Myb domain
SMARTSM007171.2E-1475123IPR001005SANT/Myb domain
PfamPF002496.8E-1576119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.0E-2378123IPR009057Homeodomain-like
CDDcd001672.81E-1180119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MAPRDQREMS SDEESAASGD LRRGPWTVEE DLLLVNYIAV HGEGRWNALA RCAGLRRTGK  60
SCRLRWLNYL RPDLRRGNIT AQEQLLILEL HSRWGNRWSK IAQHLPGRTD NEIKNYWRTR  120
VQKHARQLNC DVNSQQFKDL MRYLWMPRLL ERIGSGDGAD VATTAYDAPP PQLPASWPVD  180
DVELSCTTDA SSSSVSTDGT YQQQLLQHQL VSPPPPPAPS AAFGESAPSG NNEGSYSYSN  240
SSSNAAAMWD TLCQPPPQTD CHPTTVAETA CSWSDESLLL PGLSGDMGMG LSELGDTMWG  300
AGADDLWYTQ IMGL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-23201234106B-MYB
1h8a_C3e-232011724120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794341e-160HF679434.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB28 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958743.10.0PREDICTED: myb-related protein 330-like
TrEMBLK3ZVF30.0K3ZVF3_SETIT; Uncharacterized protein
STRINGSi030584m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.12e-82myb domain protein 112